DPCstruct | MC12201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 147 ± 15 aa |
| Standard deviation of domain lengths | 14.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 24.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0P9N3 | 1-115 | MAKEYNYIYEQLVDSDDDIHGIISYSVYKRQKIQFIKDLKQKHQRDPIDSDLQPFNELSMSPAQLEFYRSEATHILDIIKGAAGSLL… |
| A0A1H1KFR4 | 47-198 | QRNPVFAELVQGEEDLAGLVGYALYKLNKRDWLASFFKTHGRDPTEDEVESYILGERTQRRLTTYRRLAEDMIGRKAAIAERNDAAA… |
| A0A1G7TD42 | 11-150 | None |
| D2Z3R6 | 1-137 | None |
| A0A1Y4FNS7 | 2-168 | None |
| U2LL34 | 2-158 | None |
| A0A4Q4AYZ7 | 26-161 | None |
| A0A3N2MYD7 | 44-188 | None |
| A0A526S719 | 20-180 | None |
| A0A266LLW2 | 3-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.