DPCstruct | MC1220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 57 ± 4 aa |
| Standard deviation of domain lengths | 4.03 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 42.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H2JCK3 | 7-61 | WSIACRDVNGREGTLCVAVRDSEVVVVAPPGESSIFDYGAAAKFRSAVMKAAEVA |
| A0A4R2JYS7 | 6-60 | WDFGCHDLFGRDRALTVLVDHGRVLLVPPAGASAVLSAQQTRSLRQALDQAEDRA |
| A0A840Q1J2 | 25-80 | None |
| W7J449 | 1-59 | None |
| A0A4R2QVJ0 | 70-134 | None |
| A0A2S6H097 | 1-51 | None |
| A0A839XJC4 | 82-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.