DPCstruct | MC122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 257 ± 16 aa |
| Standard deviation of domain lengths | 16.14 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 65.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6MF93 | 54-286 | PAASPLLEESKYVGIHKTDDSSMHQLQPPQSQAWSFQDLQDMQFVSLPNLEIGLMTPPLTFIEETEPSTPVSLGRRDSMFESPRADS… |
| A0A7I9BQC2 | 1-252 | MFFVLIFQICDFTDKTRISSLPSAKFSLSLSNSPSPPPPSSSSLKHGEAIISNTSESSDIFADPNSFEKDTMPLTQELTLENLNNQL… |
| A0A7D9GXL8 | 160-435 | None |
| A0A1E3PQD4 | 197-435 | None |
| A0A1E3NHT3 | 146-395 | None |
| A0A4T0WXV0 | 20-285 | None |
| A0A1X7R449 | 101-369 | None |
| A0A5E8BJ86 | 378-637 | None |
| G3BCY2 | 1-286 | None |
| A0A4C2E5G3 | 41-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.