DPCstruct | MC12199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 186 ± 25 aa |
| Standard deviation of domain lengths | 24.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 16.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7EFD4 | 2-164 | KSYQFLDASGNPMEKFVKGATESIHYLVKTDGSESKDNYTSVSHSLRDVTVSGFLGPNRVWNGFASSADTNSYKEDLSTRKYTGLSV… |
| A0A1W9S6B9 | 6-179 | WYEFYLDFALDSSSMVMVDSFRFEQGDAYQELPDSNTTAFEYRTRLDGEYNNADTSMSVTYHDAYRFTGINTDEITVNGTSIAEQEG… |
| A0A1M7P752 | 93-272 | None |
| A0A6I4IPE2 | 79-243 | None |
| A0A7Y5L947 | 65-265 | None |
| A0A6M1T0F5 | 104-306 | None |
| A0A7W9XLN0 | 1-189 | None |
| A0A2V7SQ82 | 117-350 | None |
| A0A3D4UWB1 | 38-238 | None |
| A0A521FD59 | 103-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.