DPCstruct | MC12197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 114 ± 12 aa |
| Standard deviation of domain lengths | 11.89 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N9RH72 | 1-116 | MNSDLKFGEDLANKVVQYLMKQTQISNYHKEYCGTGFYFDGQNIFYTHFFDGYPDLEHYQNSENRYSGIIRTFHEMMEFQDWLANQS… |
| A0A021WXW3 | 46-172 | RRIALSLRDALSRKPLGATLAEQLWRKLANEVPGNGVIYDYHRDFCGQGLIRTDDGVMLADVQDGGAYFGSPIAAWKTEEDFVAFLA… |
| A0A3D0R795 | 3-106 | None |
| A0A0G4G8R9 | 14-135 | None |
| A0A0G4G5N1 | 4-114 | None |
| A0A848EA44 | 21-145 | None |
| A0A1Q4R823 | 1-118 | None |
| A0A0N0UYJ2 | 9-120 | None |
| A0A3A8Q9N1 | 26-134 | None |
| A0A085WWF3 | 153-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.