DPCstruct | MC12196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 156 ± 21 aa |
| Standard deviation of domain lengths | 20.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2DEJ3 | 2-137 | KNDTAKDWMGDLKHLKLLKYTYKGKIKSEKDKYSVIEATYSDKAPAVSMLPNLVISDTTYTETDMTIHQKIYPQFKIVTVRQMVDAG… |
| U6RAZ6 | 1-182 | MKYINIVIIFFFISHTVSAQASKTSIYEYGSEIQTCEDNFNNLFRNWTPNIVETANDLQLLSYEFVEELNTSRKIKRDIKWFSNPNT… |
| A0A4R3KT54 | 47-226 | None |
| A0A840D6T3 | 29-201 | None |
| A0A4Q0ME34 | 1-171 | None |
| R5SX58 | 1-141 | None |
| A0A412TVI4 | 1-159 | None |
| I8W1Y7 | 19-169 | None |
| A0A5B8VNG3 | 37-166 | None |
| A0A401M004 | 113-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.