DPCstruct | MC12193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 139 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Standard deviation of domain lengths | 13.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 15.97 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF03963- CL0424 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4QC72 | 514-621 | KEQFQIFSNLALNLNNNGFTMFVKGEDGKDGVLQFRKKPGGGVLTPKSVEFYSAFEHLGPIAGEIWQYNDKTYLSLDVEFESTMKAL… |
| W4RI96 | 19-96 | RVLFYLKLEHLDDVIVDMQVQNRIMSVQIFNENPTLRKMAEEMTPLLKLKLAEIDYHLSSVHFHVPGQSQTGRNQRSL |
| Q1NIM6 | 83-184 | None |
| A0A513RHG1 | 1029-1142 | None |
| F2J490 | 314-415 | None |
| A0A351PTA5 | 373-486 | None |
| A0A2E4A0E1 | 575-703 | None |
| A0A7C8D6Y6 | 823-942 | None |
| A0A2G4YSH6 | 946-1079 | None |
| A0A7Y5EWE1 | 148-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.