DPCstruct | MC12192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Standard deviation of domain lengths | 12.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4RHP9 | 1-102 | MKTIVKVILASALLLLITLPATTGAEENSNSPMHWGFKKGRNGRQADAGRMFEVILEDHGAVYKGDKNSKDIYLTFDNGYENGYTEK… |
| A0A1V2LXV9 | 1-73 | MNTVHNWGIAREKNHQTPKSDPLKFNITDYDAYYVGDINEKIIYLTFDEGYEKGYTPAILDVLKANEMFHIFF |
| A0A1V5L2G2 | 114-195 | None |
| W4V4J0 | 79-155 | None |
| R5YJ61 | 16-122 | None |
| A0A0L6JK64 | 74-153 | None |
| K4LU77 | 79-164 | None |
| C2YLL2 | 1-100 | None |
| R6XM60 | 11-114 | None |
| A0A068N9K6 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.