DPCstruct | MC12191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 160 ± 27 aa |
| Standard deviation of domain lengths | 26.89 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B1L191 | 16-200 | GFFEPIAKWLGEVVFYAVPIGGTDLPLIVAWLVVAGLVFTGWFGFIQFRKFRLAVDVVRGKYDEKGSAGEVNHFQALTAAVSGTVGL… |
| W4RH96 | 4-163 | EDWIGKISGWVWGPPLLILLVGTGIYLTFRIGFLQMRLLPYSLKLAFTKKQDKRSEGDISHFQALMTALAATVGTGNIAGVATAIFT… |
| A0A1U7EE60 | 5-171 | None |
| A0A447LTP1 | 17-175 | None |
| A0A7C6J1E1 | 4-130 | None |
| A0A1H9WCQ4 | 2-143 | None |
| A0A7G9ZBR3 | 5-111 | None |
| A0A3M1HVV8 | 6-155 | None |
| T0DVU3 | 5-166 | None |
| A0A376VY80 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.