DPCstruct | MC1219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Standard deviation of domain lengths | 7.85 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644U8Y9 | 49-126 | KNTITITSLPSASGTGLPYVWTTNTWKNYCPLCGKYGGLLINPKGVYEKEITCKYCDADYCGSSGKDKAYGSRATLIR |
| A0A1D3L0L2 | 101-190 | VYKSVAGYNVKKTSSTVTATAKCSCGACGNYNYHTASFKNYCPHCHKSGVLVWNPKGTAEGEWTCSSCGADYCAADGKEKVYSSPKY… |
| A0A219AK95 | 65-157 | None |
| A0A843AD13 | 402-497 | None |
| A0A1D2W484 | 5-105 | None |
| A0A6A8RP76 | 198-284 | None |
| U6EEL4 | 25-108 | None |
| A0A843GCS4 | 67-157 | None |
| A0A347AFG2 | 366-463 | None |
| A0A366ME51 | 27-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.