DPCstruct | MC12188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 152 ± 16 aa |
| Standard deviation of domain lengths | 16.18 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7MZE2 | 66-220 | RDQVRLCCNVNTKPAARDSAVEWVFVPGTRDKLGLDFALCCRALGARPHLIQVRALYQLYIRQIIFPRPLPFLATPLPELLACEILY… |
| A0A3P0PEW3 | 24-190 | IRFFFGESSRDLVLRDALLAISESIRIDVFRLRLVYEMYLTEFRVNAAFGFDAAPCPDLVVGNAGWICGDTGKWIVAEAWQQPGISK… |
| A0A1D8KCP6 | 4-156 | None |
| A0A522RP54 | 98-251 | None |
| Q5NX35 | 124-301 | None |
| A0A7W6Z5K1 | 126-291 | None |
| A0A2I1DPE1 | 11-155 | None |
| A0A811C4Q2 | 19-147 | None |
| B7J8T4 | 194-366 | None |
| A0A7T4WGD7 | 89-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.