DPCstruct | MC12186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 86 ± 4 aa |
| Standard deviation of domain lengths | 4.42 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7QWF4 | 1-81 | MSSYPNSREACAYIQGKVVNIVPTNDPNYNDKYNSIYNHGYGEPAGTLGINCRHKLFPFTPGVNVNNMTQYNPKEAIRNGN |
| A0A5B7T281 | 19-111 | QYKWISTGSWRCKNFPVCALIQGKIVNTVPRTDKHFNPRYPTSYDHGYGYAWGTQGANCRHELYPYIEGVNTNPFHHPDTKKKLKMA… |
| A0A386PSY2 | 25-104 | None |
| A0A3S4NCY8 | 10-101 | None |
| A0A2R3JYJ6 | 11-97 | None |
| W7C3U7 | 23-107 | None |
| A0A5C8H7L4 | 1-81 | None |
| A0A0R2J267 | 8-92 | None |
| A0A1Q2T4X9 | 93-180 | None |
| D0DR80 | 106-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.