DPCstruct | MC12183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 624 ± 75 aa |
| Standard deviation of domain lengths | 75.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.94 |
| Pfam Score | 86.17 |
| Assigned Pfam label(s) | PF00082- CL0020- CL0202- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9MM48 | 21-643 | PVILSPTHNYPILGGIDDFVMARGLIGINGHESKQNFFINHGVRVEHDDNLLITGGYGPMGNGALKPDVISPSNYVSTALGFIEGRA… |
| A0A2W4L2T5 | 2-604 | LAVMAAGNGGPGLETAVPLPDDVALVVGAFLPGQTAALLGDPAGERLLPYSAAGPAKDGTPAPSLIAPGLTYAPVPSWEAAGWPGGL… |
| A0A1W9RI96 | 361-974 | None |
| A0A6H5GJE3 | 376-976 | None |
| A0A2W5YXJ6 | 440-991 | None |
| A0A822EX49 | 64-647 | None |
| A0A1Q7E444 | 257-867 | None |
| A0A0B1TQT1 | 2-552 | None |
| A0A7Y4RKY6 | 3-424 | None |
| A0A7W1BDY2 | 38-611 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.