DPCstruct | MC12180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 115 ± 9 aa |
| Standard deviation of domain lengths | 8.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G9Z9E0 | 1-103 | MRIRKTKVLDFLMRCQIERGGYTGNGIAKLAKNIPVSPQALRKQINYWTSIDQAFNQLSYLGQRTISITLDDFILINQRLKEKPLGR… |
| A0A098EC99 | 2-122 | KINSDRVVGYLKQLQEKHGGYYGTDIVNLANDLGVTWHGLKKRLSFWKKNDSAFKSFVYLGQHRPPITLNEFMEIKSRISSNPLEIK… |
| A0A1D2R8M8 | 2-122 | None |
| A0A1D2R255 | 3-122 | None |
| A0A1E7J032 | 2-118 | None |
| A0A7J9TL23 | 4-122 | None |
| A0A098E6Z0 | 1-123 | None |
| D1JIR0 | 2-126 | None |
| A0A7C1AGF6 | 1-103 | None |
| A0A419JXV3 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.