DPCstruct | MC1218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 5.68 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5K0W8 | 3-57 | EWQKMGLTDEEYQLIIDRLGREPNYTELGMISVMWSEHCSYKNSRAILKTLPTSG |
| K6S0F5 | 1-70 | MVHVEMSPEAIATQKPYLDLGLTEAEYDRFAELIGHQPNDTEIGLASGMWSEHCAYKYSKPVLRQFWTKK |
| A0A380EI80 | 1-71 | None |
| A0A2G2NDN3 | 8-69 | None |
| A0A0E9LXH1 | 1-64 | None |
| T2IB51 | 5-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.