DPCstruct | MC12179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 225 ± 20 aa |
| Standard deviation of domain lengths | 19.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 13.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5UTA9 | 432-650 | VMVRATFQGSVQGRGTGLTYDFKQTNLLNGYIVNQVNRDSVYKNLNVYADLDIYQWTTRTFNCTYVNCTFHSSPEAELYNEPLWYYI… |
| A0A7C5IXC4 | 137-338 | GWGFVFKDSVNTVLYNSMFTWLVFTEFAEASAYNIHAETVSLNHYSRVNATDSNVDRVELYGQSVIWAVNSTATSTQIYGQAMIYVN… |
| A0A497SGE5 | 12-219 | None |
| A0A7C0Y909 | 161-377 | None |
| A0A534JYU5 | 275-501 | None |
| A0A518ALU6 | 544-785 | None |
| A0A2U0S882 | 1-241 | None |
| A0A523YH72 | 637-868 | None |
| A0A661KSF8 | 142-408 | None |
| A0A662G4Y1 | 11-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.