DPCstruct | MC12176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 283 ± 25 aa |
| Standard deviation of domain lengths | 25.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20248 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E8AY66 | 1-308 | MQYLAQYWSLIFLILSLAKKLLATRRPLKVRHKAIGLRLDFGSESSLQLHPVFDLAQGFSLDLSDPGLFDIPGGLGDIVQPERARIA… |
| A0A6C1P619 | 101-405 | LAQTSNIVAYVDENKKTFDMNLNGTFGWSNVQLGPVKNVNLGLGFQGLGFTYNSQNQNGFQFAIGSWSFASEQKFLANFPVTIDNIG… |
| A0A521C1G8 | 418-687 | None |
| A0A7Z8YD51 | 257-506 | None |
| A0A1L9V222 | 34-319 | None |
| A0A2W6WFD1 | 287-584 | None |
| A0A369JME3 | 346-652 | None |
| A0A2V5LNZ6 | 254-517 | None |
| A0A535CFV5 | 21-283 | None |
| A0A7C8RHN9 | 1-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.