DPCstruct | MC12173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 190 ± 36 aa |
| Standard deviation of domain lengths | 35.57 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354I2Y8 | 1-191 | MGDVSIKMYDKFGCVLRIESTCNDIGTFRVKRKVEHRDGSSSEQKAPLKKSIYSLYQLFTIMKAANYRYLEFISSFDDHSGGKENLT… |
| A0A2V8VBK7 | 18-201 | RVTKRLRGKLYSVLEKLDHGHHVMRIYCKNLVGRMYEKFSTFLRVEVCVNRMKDLGLNKGTENLECLRQKLVDITHRFAGFEAQSLN… |
| A0A498R2F7 | 176-359 | None |
| Q0S067 | 89-270 | None |
| A0A1F4DKT8 | 36-244 | None |
| A0A3D5DYQ3 | 3-172 | None |
| A0A7Y5SGM3 | 69-256 | None |
| A0A158EMR6 | 38-203 | None |
| A0A081HXW5 | 248-510 | None |
| A0A7V0UIU3 | 60-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.