DPCstruct | MC12170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 95 ± 5 aa |
| Standard deviation of domain lengths | 4.70 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0XW25 | 18-103 | MRHDDLYMIIDCVPADPKAPSGHKHNSRLSFELFAYGKSFIIDPGAYIYTADKEMRNLFRSTRYHNTVVVDSEEQNRFDEDELFTM |
| A0A2V8UZT5 | 1-97 | MLVEDLRLVVRVGPFGAGSAGHSHCDVLSFTLSEAATDVLVDPGTYTYVADAALRDWFRGSAAHNSIRVDRSDQVIAAGPFRWSHTL… |
| A0A6N4WFG7 | 355-452 | None |
| A0A2V9YHM2 | 836-932 | None |
| B5GZE1 | 189-281 | None |
| A0A6H9LB65 | 93-190 | None |
| A0A7G5BXN0 | 383-480 | None |
| A0A7D6VH94 | 139-235 | None |
| A0A0T2ZGB5 | 423-521 | None |
| A0A5D6VYP3 | 490-575 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.