DPCstruct | MC12167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Standard deviation of domain lengths | 9.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 45.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9GUS3 | 46-121 | VSGHASTEPVSFAYETLAALSKQGCNAGACHGSPSGKGGFRLSLRAFDASIDRVTLIREDFGRRTNVLDAEESLLL |
| A0A2V8UN27 | 1-101 | MKLRNLILLPAMIAAPLAAARREIPKLSFVKDIVPIFTKSGCANSNCHGSIRGQAGFKLSLFGYEPDLDYDAIVNVQDGRRINRTDP… |
| A0A3D5D6B0 | 453-521 | None |
| A0A3L7VH04 | 118-188 | None |
| A0A5C6M3K5 | 1-67 | None |
| A0A388QUN5 | 230-299 | None |
| A0A3D5JXQ0 | 1-83 | None |
| A0A517RI37 | 318-388 | None |
| A0A800MAP2 | 55-136 | None |
| A0A2V8VG57 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.