DPCstruct | MC12165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 146 ± 37 aa |
| Standard deviation of domain lengths | 37.41 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 74.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.13 |
| Pfam Score | 71.67 |
| Assigned Pfam label(s) | CL0123- CL0481- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257N5A5 | 20-126 | KFVPTELLRPVTAQKSERITPEIQESSSEDSPKDFILNALEKICKDGGWTNLANLGNYLTKLKPDFDVRLYGFKSLGAMVKAHKDIF… |
| A0A373ZDV6 | 83-216 | GIDIVTDDDTILAAVVKAQEQGKNIRVFGSNAHSESFIRRCNRFCYIDILQGYEPEQCLTPLSEIVSDVYRIIIEERASGICTELAG… |
| A0A1H5T8R6 | 55-169 | None |
| A0A061QXK4 | 129-279 | None |
| W7Z8B4 | 84-234 | None |
| A0A0F9N8U9 | 91-257 | None |
| A0A5M9L2M2 | 23-176 | None |
| A0A3L6MYK2 | 465-565 | None |
| A0A651EEQ6 | 123-287 | None |
| A0A5N6G266 | 18-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.