DPCstruct | MC1216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 94.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 44.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P1AMK7 | 1-60 | MKTMYDVRQLLKRYGTIIYTRDREFDLSLMEEEFRELHKWKMIEDNTFRQGLLIIRNEMR |
| A4VX11 | 17-85 | NFFMKRLYDVQQLLKRFGIIVYMGNRLYDIEMMQIELNRIYQAGVLDRLEYMEAELVLRREHRLELEYQ |
| A0A2T5G957 | 8-72 | None |
| A0A2T4ZDN9 | 8-77 | None |
| A0A2N0ZHB6 | 1-65 | None |
| A0A1H8AGK7 | 1-57 | None |
| A0A2P8H7W7 | 1-61 | None |
| C2EW48 | 1-73 | None |
| A0A223ZT01 | 25-98 | None |
| A0A0R2BVV0 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.