DPCstruct | MC12156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 126 ± 14 aa |
| Standard deviation of domain lengths | 14.24 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X0QLX9 | 5-109 | STSPKLVTLIYVCHICEEMKFEGRNLRSHLLSGHLIEVPKLKRGQRHRDSLQYAFVKSKNNKIHQAIAQRYACPSCLSHFLTIDEYK… |
| A0A163J3H0 | 5-131 | PKLVRIQHLCFECPTLFTKPQSLRNHLRRHGIELPQNRTGIRRYDTEDVIFVKTLSNHPIVATHLGCPACIVHCADVAELKTHYIDH… |
| A0A1X2GM26 | 1-133 | None |
| A0A1X2GS24 | 95-228 | None |
| A0A367KLX6 | 149-270 | None |
| A0A1X0S6A5 | 2-147 | None |
| I1C3D0 | 2-140 | None |
| A0A1X2GK69 | 8-118 | None |
| A0A162R7V7 | 20-153 | None |
| A0A1X2GA04 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.