DPCstruct | MC12153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 180 |
|---|---|
| Mean domain length (aa) | 245 ± 51 aa |
| Standard deviation of domain lengths | 51.21 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.75 |
| Pfam Score | 92.97 |
| Assigned Pfam label(s) | CL0704- CL0245- PF02734 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T6E4J1 | 5-250 | LITDPTCHLPAGALKRFPIDRLTPSDTFDERLSEQWLYHCDALLGIGSTLSIESWQTVIAQRHDELSPRRLSAHLRTPFYVRLFHSQ… |
| A0A6N2TXZ0 | 6-280 | AFISGGGGGHEPLDSGFVAPGMLHACVTGPRFTSPSAPDIAQLMEEVTAELGVNTIVALVKNYTGDVMNFELAAELAAASGLECIMI… |
| A0A4U0VQW4 | 39-378 | None |
| A0A811MH20 | 234-450 | None |
| A0A6A4H208 | 36-391 | None |
| A0A327VF71 | 21-237 | None |
| A0A1A9X9T2 | 134-306 | None |
| A0A6B1E3Y9 | 61-340 | None |
| A0A3M1BR21 | 13-228 | None |
| K8FCA7 | 320-705 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.