DPCstruct | MC12152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 238 ± 24 aa |
| Standard deviation of domain lengths | 23.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4ZSL2 | 21-255 | KPTSGVAPDASAPGDAAARAADAGPDAAEEVHSVYPDLEGAPEPLALRLCAALHEAPEARRAECCHEPKGVVMASECTRMLTAALRS… |
| A0A0K1ERH8 | 65-294 | KSTAHAGAGRDARGSTSAGAEAGAGSDEVRPVYPVTGEAPEAVAVRLCEALHALPSARKAACRGGTEGFHAGAECARTLSEALRAGA… |
| A0A7C5J547 | 1-230 | None |
| A0A7Y4ZNT5 | 40-313 | None |
| A0A7Y4ZP58 | 75-299 | None |
| A0A7Y4ZRT7 | 263-475 | None |
| A0A4P2Q8V8 | 28-254 | None |
| A0A4P2R1W7 | 48-268 | None |
| A0A7W1AJG7 | 49-265 | None |
| A0A2F0ASL3 | 49-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.