DPCstruct | MC12150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 288 ± 45 aa |
| Standard deviation of domain lengths | 45.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K1EIU8 | 1-351 | MKPVRARSVDAEIDALYGRSPHAFTASRNDLSARLRREGKRTEAAEVQRLKRPGPVAFGVNLLYRKRRDDLEALLDAGNAARGAQLA… |
| A0A2T0SXA2 | 1-264 | MAAALGSGQTGRITDTSDVDQAADELYSLPPADFVTARTKRVTAAPDKDTARAIAALRRPTVAAWAVNRLVRDGHALVDEAFDLGSR… |
| A0A5S4ZBQ2 | 358-657 | None |
| A0A7W1LRF3 | 7-274 | None |
| A0A7W0JKM3 | 2-222 | None |
| F4H3L6 | 4-359 | None |
| A0A534NRG3 | 263-505 | None |
| A0A536CGK1 | 2-242 | None |
| A0A5N6MFC3 | 1-326 | None |
| A0A2V7YTK0 | 12-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.