DPCstruct | MC1215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 155 ± 17 aa |
| Standard deviation of domain lengths | 16.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M8B9Y3 | 119-278 | ARERIKNINWENNGMDKPSYAILVTEFIRRGNIFLDFNSKDDNRRAVFNAAEIINFDTPAHIKEECNGVVNANVDWVTEYLCAFYLE… |
| A0A5N5EMV6 | 2-160 | SDRLRAIDWGDDGAAFRHAHSRALLMREYLRRAALWAQVCGAEESWPFFDIAERLDAAITTPPDVAAELEQLLQSLAPASLRTTCRG… |
| A0A0D3VFZ9 | 19-201 | None |
| A0A223QKF6 | 1-138 | None |
| A0A1I3HTD4 | 5-142 | None |
| A0A2T0PPT6 | 11-185 | None |
| A0A495L2A1 | 7-165 | None |
| A0A7X6CNJ3 | 10-172 | None |
| A0A4R6KTQ2 | 10-137 | None |
| B5H304 | 54-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.