DPCstruct | MC12149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 78 ± 7 aa |
| Standard deviation of domain lengths | 6.80 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P2Q0C1 | 1-71 | MKRRFNTTGPCRPDLHYMIPAESRLPEAPGLVEQMGYFVVHAPRQTGKTTALRAVAERLTASGRHAAVLFS |
| A0A0K1EAW9 | 1-79 | MQRRFNTAGPCIADRHDMIPAERRLPEAPALIEQMGYFAIHAPPRTGKTTALRALAEALTSSGRYAAVAFSYESGAPYG |
| K9RNZ9 | 1-68 | None |
| A0A174ACM6 | 1-84 | None |
| A0A3D3FHA6 | 1-81 | None |
| A0A853M9F4 | 1-80 | None |
| A0A1Q6V038 | 94-179 | None |
| A0A4P2R4T1 | 1-85 | None |
| A0A351THL1 | 19-101 | None |
| A0A450SER8 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.