DPCstruct | MC12146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 102 ± 5 aa |
| Standard deviation of domain lengths | 4.99 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U1GZB3 | 1-103 | MRRILTFLAGFALASASAACGSQVAELCDAKCDCENCSDTEYDECVITYEAEQDIASSYGCLDKFDDRHFCIMDRYRCTLDIFDYAI… |
| A0A0K1E9V3 | 37-142 | MRRSASTVLFRAVFLATSVVIGIGASGCRSAVGTICDTKCDCEGCSNREYNECIDDVERDERRAVNRRCADEFDEWVACVDDTATCR… |
| A0A850BI35 | 11-117 | None |
| A0A534PL94 | 1-95 | None |
| A0A661NN40 | 2-100 | None |
| A0A849ZAJ4 | 1-103 | None |
| A0A849ZA78 | 5-106 | None |
| A0A150RC31 | 1-107 | None |
| A0A1L6L7N9 | 10-108 | None |
| A0A0K1EAF9 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.