DPCstruct | MC12143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 251 ± 19 aa |
| Standard deviation of domain lengths | 18.61 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A430KZ58 | 7-272 | GALVHATARGRPEAYMKWIVMKYAEMLIAAGDAHFRQGTLESLPLAIQRYVEAGHILGPEPPKVPKLGNKKPRTFANLSQEDAQLEL… |
| A0A3S4CUI4 | 71-323 | SVDPDAVAQNDPMHYKVSTLMKLLDLLIARGDSAYRMLERDTLNEAKMWYMQALGLLGDKPLTTISGAWSNPALSDAADKTQAKQFH… |
| A0A2X4T5F1 | 243-493 | None |
| A0A849EWZ7 | 274-542 | None |
| A0A7Y5J661 | 138-414 | None |
| A0A0L0JGV6 | 81-346 | None |
| A0A4D7JGN6 | 466-717 | None |
| A0A3Q9D790 | 125-338 | None |
| U1HTU8 | 337-606 | None |
| E5ARL0 | 150-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.