DPCstruct | MC12142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 121 ± 18 aa |
| Standard deviation of domain lengths | 18.27 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9W1Q7 | 47-162 | QLQQHRLSSFSSQTSFINRNQEEKVWMYIAGFGGTSRAWAACTPRMMPNDFKLKSVYGVGVDWPVTYEELEPYYTEAEKVMAVSGPD… |
| V6DW55 | 1-93 | MKGVGGSTLHWQGMVMRLHEGDFNSGTERGVGPDWPIDYADLRPYYAEAERELGVAGASDNPYAPPREEPHPMPAFEPSYSDSLFAE… |
| A0A1G6L8L0 | 21-152 | None |
| A0A1W6P384 | 54-205 | None |
| A0A6M0F5W8 | 88-200 | None |
| Q52TA3 | 115-208 | None |
| A0A2V9A166 | 78-188 | None |
| W7Y7K4 | 49-193 | None |
| A0A2V9J925 | 22-120 | None |
| A0A0B0HY13 | 23-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.