DPCstruct | MC12141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 59 ± 3 aa |
| Standard deviation of domain lengths | 2.60 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 94.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 56.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1QBW1 | 11-67 | MPGGAAQKPGDVIKHYGGKTSEVLNTDAEGRLILADALALLAEKKPSCIVDTATLTG |
| A0A0K8Q782 | 1-59 | MPSGAAQRPADVLTMFGGKTVEVLNTDAEGRLVMADGIVAASQEYPDAIIDVATLRGRN |
| A0A4U9HNR6 | 40-104 | None |
| A0A380EGI0 | 1-57 | None |
| A0A1V3WZ80 | 27-83 | None |
| A0A444ZZX2 | 1-59 | None |
| A0A2X2BKQ5 | 12-68 | None |
| A0A2V7Z8E8 | 125-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.