DPCstruct | MC12140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 147 ± 20 aa |
| Standard deviation of domain lengths | 19.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A7KC72 | 62-191 | FEWYRNCEHRFNSEFGFQSFPEPKTVYNYTLAKDRNISSYIMEEHQRSGIGNTTIIQYMLDWFRLPTSFDNQLWLSQILQGLGVKYA… |
| A0A0K8Q776 | 5-139 | DVWNQKDYSHYAQWNPRFVSEFGFQGPPNWSTLTRVLEPADMDLEAPAFLQHQKAEDGTEKLEKGLAAHLHEPANFQEWHFLTQINQ… |
| A0A350UKL8 | 807-957 | None |
| A0A0B8P1E2 | 140-256 | None |
| A0A2J6JKI4 | 32-190 | None |
| A0A1L9T7L4 | 491-642 | None |
| A0A814TCH4 | 321-475 | None |
| A0A0J1G8J0 | 336-481 | None |
| A0A2V9ZWR8 | 46-190 | None |
| A0A645C5J7 | 4-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.