DPCstruct | MC1214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 230 ± 15 aa |
| Standard deviation of domain lengths | 15.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A221KCR3 | 2-212 | VALEGVYVPALFLTGSGGKSAEAGQRAQAAMQRLAQAWVTLRPTFAGLWPRDAAWQRSVGQVQQHIDEGAQRTQQGAWAAAHEALEH… |
| A0A1Q3W2Z8 | 1-243 | MSICKNLSVVTAVCAIFTAASALAGDLSNFNEAIEKVAAHNRVATNYLRTGNADLAAIELDDMRGAWSKLTKRFEGKTPDAFADNAL… |
| A0A5C6A8S5 | 152-381 | None |
| A0A5C5YQD6 | 180-406 | None |
| A0A0S7Y202 | 1-255 | None |
| A0A1J5JCU5 | 91-300 | None |
| A0A0M3QF10 | 15-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.