DPCstruct | MC12137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 187 ± 16 aa |
| Standard deviation of domain lengths | 16.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z5URW8 | 23-201 | TDHDWLSAALEAANVPTLACLLVQMTGDRRWIEGKFVPSRTRGMDDNDSGGLPDDVQQEIRHAAHAALIRHFAGEPVVIADPSDELL… |
| A0A2U3N6E0 | 16-168 | DLDLDELRANLRQADPGVLVAVLAQLTGDAAVVDRFAPKISHVPDPPEQAGVTDPETAAALVEAVVAALRSPRPSGALPVDDLDLFA… |
| A0A812HAB1 | 8-194 | None |
| A0A2E7MRS8 | 3-203 | None |
| A0A1V3XFE1 | 1-157 | None |
| A0A7U1HTR7 | 2-197 | None |
| A0A7I9VUA6 | 11-204 | None |
| A0A2Z5TAN0 | 1-189 | None |
| A0A7I7QUY3 | 1-207 | None |
| A0A6A6F8V2 | 36-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.