DPCstruct | MC12136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 166 ± 17 aa |
| Standard deviation of domain lengths | 17.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A520LF05 | 73-252 | IAFLIGEFALISVALRGAIPPDETREVSAYSPWSEEVLKIAEAIPVQEGGRIKPLRTYARFKMMSFHGSLTMKVKAGGKVHKIGPVA… |
| A0A3N5F9M2 | 1-163 | MKKAVPWVALFVLMLSVTVLMLRPTPSAGSFNLEEFARLPVMMDGRVQPIESAARSALLRIRQTPTLPVEGGRTLQSTEWLLEALVK… |
| A0A6B2M5B9 | 8-166 | None |
| A0A6C9ILY7 | 90-250 | None |
| A0A2A5AD89 | 4-141 | None |
| A0A255S3C8 | 246-394 | None |
| A0A7V3TW19 | 1-193 | None |
| A0A2V6J0W0 | 1-188 | None |
| A0A3M1BAB0 | 1-159 | None |
| A0A2V8ER12 | 1-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.