DPCstruct | MC12135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 541 ± 97 aa |
| Standard deviation of domain lengths | 97.21 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 66.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4RN26 | 2-724 | AETAQTGIPFGKRFPSVYGPFRLVLAILLLLPLAYGYNTGQYMTLYMAKWGSSFATNAWLSYNEVMSTTSSNNPLGLSPQEIIGNPN… |
| A0A354Z810 | 57-562 | VQTRTSYVKSWVPTNEIASVGSSSLGWLTGTGYKPVQIPVTNFAWEATGGYVNPAVCGGLRWEESPQSQEGNARYLDLSGIAQVHGQ… |
| A0A7H8E0U3 | 114-819 | None |
| A0A0L0M4A9 | 56-569 | None |
| A0A2A3VRS1 | 2-431 | None |
| A0A2L0X9C5 | 220-772 | None |
| A0A350YKQ7 | 103-706 | None |
| A0A0N1N3R1 | 5-505 | None |
| A0A269XWL1 | 1-438 | None |
| A0A0M0EE32 | 2-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.