DPCstruct | MC12131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 11.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C0VFS0 | 1-104 | MISFYQRLQKIKEKPGLYIGYPSVSDLFIFLCGYRRACQDMGLTLSDEELQFHEFQPWLQKRFRLSTSASWAKIILLYSSDENHAFQ… |
| A0A139X6S2 | 4-101 | GLYKILEKIRVRPGMYIGKASVTVLFDFLVGYKTARRELGIELTDEDADFCEHFHEFVERKHHLRTSNSWAKIIMLYCHHEKEGFDN… |
| A0A559UPI8 | 110-232 | None |
| A0A3N4ZPX2 | 77-193 | None |
| A0A386ZES7 | 6-120 | None |
| A0A6M0G602 | 93-187 | None |
| A0A251W9Z6 | 1-104 | None |
| A0A543I718 | 9-118 | None |
| G5GIZ0 | 107-224 | None |
| A0A5B9W637 | 12-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.