DPCstruct | MC1213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 103 ± 11 aa |
| Standard deviation of domain lengths | 10.61 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 22.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A239I305 | 12-113 | GKPEIPFEAAFSVTIDLSVFPREVVLRACYAFADRCHCWVQGDGPGSLLVAFRDRTGKLDAADTKGAFANALVDFALRADIETRTAD… |
| A0A3L8P7B0 | 31-132 | ITMRWHSSTTPLEAVERALYALADQVTGSVADRDGKWVLTAHPRAARADLTALEHRLRQEVNDQTLRVKIAQRTDPLRNLVFALAFS… |
| A0A1M2Z9E5 | 1-110 | None |
| A0A7Z9KX22 | 9-134 | None |
| A0A800BR64 | 6-103 | None |
| A0A1F9VCU0 | 42-158 | None |
| A0A3C1ERD7 | 1-117 | None |
| A0A1F9VHQ6 | 1-102 | None |
| A0A2H0Z9R4 | 8-98 | None |
| A0A2V6F981 | 2-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.