DPCstruct | MC12129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 110 ± 11 aa |
| Standard deviation of domain lengths | 10.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.18 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0268- CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z2XWA0 | 1-101 | MVSEEEQALIQERMAQAGIRNMGAYMRRMALCGYVLQIDLAPVRELVSLQRRCSNNLNQVAIHANTYGGIYPEEISALQRDYSALWG… |
| A0A3C1I8I0 | 1-109 | MPRTDNHQVNIRVNEAEYAKIQASARIMGLSVPKYCKHLVMQSKLKEPKLADDEYHHIIVDLSRIGNNINQIARRLNQAQGELAEEE… |
| A0A3D8TQK6 | 9-116 | None |
| A0A327X905 | 6-119 | None |
| A0A2E2EIL9 | 1-108 | None |
| A0A134AJK3 | 3-109 | None |
| A0A3A8ZI45 | 3-98 | None |
| A0A1Y4NAG6 | 1-115 | None |
| A0A7C5SMG6 | 1-118 | None |
| A0A519TEU4 | 1-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.