DPCstruct | MC12127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 10.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z8QG56 | 58-135 | GDLVLGEKLHKESCSSCHDGMVPGGNGDELYLSEFRAINSSSKLKSQVEFCANQNGVAWFEDEIESVSRYLNNNFYKF |
| A0A3B1A1G2 | 9-97 | IAAVILANTSYAGDIKRGQELHDENCTSCHKSMLGGDGSGIYTREDRRIDSYEGLVKQVKRCKTSLGVSWPEHQIDDVITYLNDSFY… |
| A0A7W5D5T5 | 11-94 | None |
| A0A536V007 | 12-119 | None |
| M1SGK4 | 2-84 | None |
| P84848 | 1-71 | None |
| A0A358JMY1 | 16-99 | None |
| A0A7C5CNL4 | 49-128 | None |
| A0A7V2SZT2 | 1-84 | None |
| A0A3N5F623 | 31-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.