DPCstruct | MC12125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 142 ± 10 aa |
| Standard deviation of domain lengths | 10.27 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A809RJF1 | 115-245 | YEPEFAIMTAMDYAKANLNGLRSKDYAIDDLNDTEKARIMYLCHHLGLADAVHFIQNTIPEEDVVVTNKKGKKVIKQNGAERLLTGQ… |
| A0A749LS40 | 5-153 | TPYPVHATAEIQQWLNLRFKPEYAIMAAVDYGVANLASLKMAGYNIDGLNDAEKAKLIYLTHHLGLSDAIHFIKNDITEGKAKELLI… |
| I2BDR4 | 246-399 | None |
| A0A4Q3MXV3 | 1-131 | None |
| A0A809SEQ3 | 1-145 | None |
| N8Y2J2 | 302-445 | None |
| A4W592 | 18-166 | None |
| A0A014M9B2 | 412-564 | None |
| A0A0Q4G7P6 | 211-336 | None |
| A0A1H0PXH5 | 68-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.