DPCstruct | MC12121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 160 ± 11 aa |
| Standard deviation of domain lengths | 11.13 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8F5I7 | 133-307 | PNFGPDTISDITINVVRGKLIEFTQQQCKALGVPMRKVAAGKVWNDSTSQWESKFAELPVYNGAPLLLVPRDIVRMSLAVDPQSYYQ… |
| W9EI86 | 71-219 | MFVPGFSYDSVSDLTTRLIEKELYNFTIETVKRLGRDNSLHKRTETLYYWADKDCEWKKENVEKNFYANGKFTLLVPNCMVEEKKFK… |
| A0A1X1Z9N0 | 2-155 | None |
| A0A840F036 | 7-162 | None |
| A0A5C5XLP1 | 79-254 | None |
| A0A7X0ZK49 | 154-311 | None |
| A0A2P6WET0 | 1-147 | None |
| A0A6N7W4R3 | 2-148 | None |
| A0A7W8M6H3 | 70-251 | None |
| C9KPH9 | 181-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.