DPCstruct | MC12120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 135 ± 16 aa |
| Standard deviation of domain lengths | 15.53 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8C826 | 17-140 | TPEKLDAIRARHAAATPGPWAWFGFVPRPKSPGLRDIYLATVNQGRRHVLDLVRWGMTDAQPRFRSGSVMVNAADVAVRRYDDANDI… |
| A0A643F539 | 3-110 | DTKFTPGPWRWEINRKHKSINLCGGLPANTFDKTVLGFERYGMNGAAPVFHNWNADGWGGPPKRVQELAVEKVGREHHADWFALIDH… |
| A0A2A3Y1G1 | 9-155 | None |
| A0A349U0M4 | 1-161 | None |
| A0A0N9HZI9 | 1-152 | None |
| A0A1H3CEU6 | 3-147 | None |
| A0A1V4EL92 | 6-135 | None |
| A0A511MW45 | 11-127 | None |
| A0A0D1VL79 | 2-134 | None |
| A0A495WNY3 | 6-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.