DPCstruct | MC1212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 143 ± 11 aa |
| Standard deviation of domain lengths | 10.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849Q2N8 | 22-168 | VSSELNCTVSNTQSLGTLVYKMSGLFNAHAELYTGSNYLYNVSCEDVTVTGVPTGINLNNNCDDIHILNLSSATNAHVEKSDQGNYL… |
| A0A0B3B5D5 | 21-165 | IYAETYQIKPSTECTPERTLLKISNSKGESTNAHGEVYNGAGNYPNAVCYMPQAFPQSETIHTCTANNANLLLKLSSTTNAHAEVKT… |
| A0A662EYR3 | 258-400 | None |
| A0A2P6W421 | 15-150 | None |
| A0A3M0Y4P9 | 23-165 | None |
| A0A256ZKQ6 | 192-318 | None |
| A0A0S7YE76 | 24-168 | None |
| A0A7J4QET3 | 13-152 | None |
| A0A1F6ZDX8 | 11-165 | None |
| A0A7J4KA71 | 16-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.