DPCstruct | MC12116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 232 ± 11 aa |
| Standard deviation of domain lengths | 11.45 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H6XNL0 | 9-236 | HNYCDRWCERCVYTDRCRVFATDREDRQVAKSDPKWETSLEPITKTLQEAIKLLNKMAREKGIDLTKTDAGFEKERAEQKTAVEKHP… |
| A0A1V5ZUS9 | 58-291 | KKKKTQDISVSPAELFKKMPFFSCDRRCDECVIGSKCSIYKDLLLLRIGRIMRGDDYKSGEQFFEDIKSSFERAEERVNRYFLKLGV… |
| A0A1F2TP66 | 13-228 | None |
| A0A1F6VIZ1 | 81-332 | None |
| A0A7C2NN82 | 17-261 | None |
| A0A1G2T119 | 126-359 | None |
| A0A1F5TQR7 | 3-235 | None |
| A0A2V8FXI1 | 6-225 | None |
| A0A2G9YD49 | 63-276 | None |
| A0A0S8HS28 | 191-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.