DPCstruct | MC12114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 5.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 36.68 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0161- CL0183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q8HSJ6 | 4-75 | SSDTDNELSRVNQALRTLSAGNRTLLHATQEQDLLHGMCQVIVNEGGYHRALLTYAQHDEQKTLLMMAYTLQ |
| A0A2N7PXM7 | 12-88 | IEFALVKIETQESLKNSIRFYNTLSKVNHLLIKSTSKNELFEKICDVFVNYGEFDLAGLFILDDKNKLKLTKYSGKN |
| A0A848QGD9 | 175-245 | None |
| A0A522WX03 | 365-431 | None |
| A0A7C5UXA5 | 482-554 | None |
| A0A011QSR9 | 634-702 | None |
| A0A364NVT7 | 1-74 | None |
| A0A349UNU3 | 195-268 | None |
| A0A1T4M039 | 118-190 | None |
| A0A1I5X6C6 | 365-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.