DPCstruct | MC12112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 8.47 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L7XEW2 | 32-147 | STEHQKQAWPKHKKLCKIYQSSNPPPADTYCGLCGNIGPLTTTECCRRTICDDEQDYQMFTYSNVSCNRNHCRYTLCSFHHNEDHGD… |
| K0NK78 | 13-98 | GEYCRFCGNDSVPLVKTKCCDQWICCDTSYVSIEGGGYCQYHHEQYSVCYFHYNDGHSGKWQECEECRDLLGEDDFKAAFHDPNNV |
| A0A660UM72 | 3-102 | None |
| A0A0W0WBX2 | 1-98 | None |
| A0A399ZF37 | 128-217 | None |
| A0A350EWE9 | 3-96 | None |
| A0A1F4RLS2 | 81-181 | None |
| A0A5C3QET2 | 19-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.