DPCstruct | MC12110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Standard deviation of domain lengths | 9.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15529 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A5UT32 | 90-172 | GRQIRGKFPPTASANEILYRADTRGRITHYQVYGADGLPVMRVDVTGKPHGGVAAPHVIEFQRHRAPDGTIYVRPSRKARPAR |
| M9LPC7 | 36-124 | DYALYGQALEKGESVPNNHSEETEKRSLPTKGQKLSSKDLVRNGKVVQRRYYDGDGNADVDIDYDHSDGDNCHTFPHRHKWTWKNGE… |
| A0A1D9FKZ7 | 43-104 | None |
| A0A133NRT4 | 106-179 | None |
| A0A1M5AMS5 | 5-78 | None |
| A0A6A8HSD3 | 10-78 | None |
| R5ZSE8 | 15-94 | None |
| A0A7C6FPJ0 | 163-241 | None |
| C0E860 | 34-105 | None |
| A0A096CTS8 | 167-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.