DPCstruct | MC1211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 151 ± 10 aa |
| Standard deviation of domain lengths | 9.76 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 16.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5XDL2 | 172-314 | QEQLIAYITKNIDSCLDFSIFAEEGFEISKNENNVAVDINDNDVTIRMNYELIVENLVSGEKTELNNFIVRHKIRLGKLHAFVNKLI… |
| A0A0B3AZ31 | 1-144 | MTDNLNNVLRNEVENCINKDLLESQKFGYEVRGSKALTTKTEAVGSGILVTVNYDIQLKKDEDITSLKPVNVVLDIPLKELYDVSYD… |
| A0A842SYI3 | 200-367 | None |
| A0A2D6SQA8 | 114-275 | None |
| A0A532T508 | 106-248 | None |
| A0A5E4JRD7 | 108-256 | None |
| A0A842UDT0 | 86-225 | None |
| A0A842TZK8 | 154-315 | None |
| A0A2G9N4L5 | 120-267 | None |
| A0A7J4JCB1 | 164-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.